PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00149279001
Common NameGSBRNA2T00149279001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 349aa    MW: 39287.6 Da    PI: 9.6362
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00149279001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.91.1e-38105165262
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          ++++++cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGg++rknk+ss
  GSBRNA2T00149279001 105 PQEKVNCPRCNSTNTKFCYYNNYSLTQPRYFCKGCRRYWTEGGSLRNVPVGGSSRKNKRSS 165
                          6899******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-30104163IPR003851Zinc finger, Dof-type
PfamPF027018.4E-33107163IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.705109163IPR003851Zinc finger, Dof-type
PROSITE patternPS013610111147IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MQRGKIYYYL LFNKLCFLLK IRYFFFVDAT KWTQDFQEMI NVKPMEQIIS NTSNNTSQQQ  60
QQQQQQQTFI ATTARPNPNA SNVGSGAGND NNTATAMEST RKARPQEKVN CPRCNSTNTK  120
FCYYNNYSLT QPRYFCKGCR RYWTEGGSLR NVPVGGSSRK NKRSSTPLAS PSNPKLPDLN  180
PPFFFATQIP NKSSKDLNLL SFPVMQDHHH GMSQFLHMPK IENNNTSSSI YASSSHGASS  240
RGMNTLLPGQ MMDSNSVLYS SLGFPTMADY KQSNNNLSFS IDHHQGIGHN TINNNHRAED  300
NNHADDMNGA SRVLFPFSDT KEFSSTNQEK SHNTYWSGMF SNTGGSSW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.144941e-71seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00149279001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794810.0JN979481.1 Brassica rapa subsp. pekinensis auxin response factor 18-1 (ARF18-1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009138746.10.0PREDICTED: dof zinc finger protein DOF3.7-like isoform X1
SwissprotQ433851e-172DOF37_ARATH; Dof zinc finger protein DOF3.7
TrEMBLA0A078DKH60.0A0A078DKH6_BRANA; BnaA04g00520D protein
STRINGBra014418.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25282673
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.41e-168Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]